PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g05400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 735aa    MW: 80877.6 Da    PI: 5.7962
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g05400genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.6e-2058113156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q++eLe++F+++++p+ ++r++L k+lgL+  qVk+WFqN+R+++k
  CA10g05400  58 KKQYHRHTQHQIQELESFFKECPHPDDKQRKDLGKRLGLEPLQVKFWFQNKRTQMK 113
                 688999***********************************************998 PP

2START212.12e-662524741206
                 HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                 ela +a++el+++a+ +ep+W +ss        +n++e+ ++f+++ +     +++ea+r+s+vv+ + ++lve+l+d++ qW++ ++    ka++lev
  CA10g05400 252 ELAVAAMEELIRLAQTGEPLWIQSSennpneVLLNEEEYARTFPRGIGpkslgFKSEASRESAVVIVNYVNLVEILMDVN-QWTNFFTgivsKATILEV 349
                 57899********************77777666788888888888888********************************.****************** PP

                 ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSX CS
       START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrl 176
                 +s+g      galq+m+ae+q+++plvp R+ +fvRy++q+ +g w++vdvSvd+ ++ +    v R++++pSg++i++++ng+skvtw+ehv++++r 
  CA10g05400 350 LSTGvagnynGALQVMTAEFQVPTPLVPtRENYFVRYCKQHADGAWAVVDVSVDNLRSTS----VSRCRRRPSGCVIQELPNGYSKVTWIEHVEVDDRA 444
                 *********************************************************975....8********************************** PP

                 XHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 177 phwllrslvksglaegaktwvatlqrqcek 206
                 +h+++r+lv sgla+gak+wvatl+r ce+
  CA10g05400 445 VHSIYRPLVDSGLAFGAKRWVATLERICER 474
                 ****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-1942115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-2146117IPR009057Homeodomain-like
PROSITE profilePS5007116.64955115IPR001356Homeobox domain
SMARTSM003893.6E-1857119IPR001356Homeobox domain
CDDcd000868.55E-1858116No hitNo description
PfamPF000468.2E-1858113IPR001356Homeobox domain
SuperFamilySSF559611.37E-40243476No hitNo description
PROSITE profilePS5084848.641243477IPR002913START domain
CDDcd088753.74E-127247473No hitNo description
SMARTSM002342.4E-64252474IPR002913START domain
PfamPF018523.7E-56253474IPR002913START domain
Gene3DG3DSA:3.30.530.206.8E-7313474IPR023393START-like domain
SuperFamilySSF559614.4E-25495726No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MFQHNMFDSH NFLLDMTRKT PENELDLIRD DEFESKSGTD IMEAPSGDDQ DPNKRPKKKQ  60
YHRHTQHQIQ ELESFFKECP HPDDKQRKDL GKRLGLEPLQ VKFWFQNKRT QMKSQHERHE  120
NTQLRNENEK LRAENIRYKE ALTTATCPNC GGPATIGEMS FDEQHLRIEN ARLREEIDRI  180
SGIAAKYVGK PMLNYPQLPS LGPPTRSPLD LGITAANLGH QLGEMFTTST SAGDLLRSIS  240
GPTEADKPII IELAVAAMEE LIRLAQTGEP LWIQSSENNP NEVLLNEEEY ARTFPRGIGP  300
KSLGFKSEAS RESAVVIVNY VNLVEILMDV NQWTNFFTGI VSKATILEVL STGVAGNYNG  360
ALQVMTAEFQ VPTPLVPTRE NYFVRYCKQH ADGAWAVVDV SVDNLRSTSV SRCRRRPSGC  420
VIQELPNGYS KVTWIEHVEV DDRAVHSIYR PLVDSGLAFG AKRWVATLER ICERLASVMA  480
SNIPTGDGKL IITSPEGRKS MLKLAERMVM SFCAGVGAST AHTWTTLSGS GADDVRVMTR  540
KSIDDPGRPP GIVLSAATSF WLPVPTKRIF DFLRDENSRN EWDILSNGGL VQEMAHIANG  600
RDSGNSVSLL RVNSGNSTQN NMLILQESCL DSTGCYVIYA PVDIAAMNVV LSGGDPDYVA  660
LLPSGFAILP DGSSNASSAE NTNVAGGSLL TVAFQILVDS VPTAKLSLGS VATVNSLIKC  720
TVERIKAAIQ GENA*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545426.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
RefseqXP_016545427.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLK4CX660.0K4CX66_SOLLC; Uncharacterized protein
STRINGSolyc10g005330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2